Web stats for Orientalcollection - orientalcollection.jp
1.67 Rating by ClearWebStats
orientalcollection.jp is 2 decades 2 years 7 months old. This website has a #1,178,219 rank in global traffic. It has a .jp as an domain extension. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, orientalcollection.jp is SAFE to browse.
Traffic Report of Orientalcollection
Daily Unique Visitors: | 408 |
Daily Pageviews: | 816 |
Estimated Valuation
Income Per Day: | $ 3.00 |
Estimated Worth: | $ 720.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,178,219 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
100
Siteadvisor Rating
Not Applicable
Where is orientalcollection.jp server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 183.90.228.30)
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Date: Tue, 27 Jun 2017 02:37:14 GMT
Server: Apache
Last-Modified: Wed, 29 Apr 2015 22:01:26 GMT
ETag: "2580048-905-514e41ee2f9f4"
Accept-Ranges: bytes
Content-Length: 2309
Content-Type: text/html
Status-Code: 403
Status: 403 Forbidden
Date: Tue, 27 Jun 2017 02:37:14 GMT
Server: Apache
Last-Modified: Wed, 29 Apr 2015 22:01:26 GMT
ETag: "2580048-905-514e41ee2f9f4"
Accept-Ranges: bytes
Content-Length: 2309
Content-Type: text/html
Domain Information for orientalcollection.jp
Domain Registrar: | Japan Registry Services |
---|---|
Registration Date: | 2001-09-07 2 decades 2 years 7 months ago |
Last Modified: | 2016-10-01 7 years 6 months 1 week ago |
Expiration Date: | 2017-09-30 6 years 6 months 1 week ago |
Owner's E-Mail: | [email protected] |
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
orientalcollection.jp | A | 86400 |
IP:183.90.228.30 |
orientalcollection.jp | NS | 86396 |
Target:ns5.xserver.jp |
orientalcollection.jp | NS | 86396 |
Target:ns3.xserver.jp |
orientalcollection.jp | NS | 86396 |
Target:ns1.xserver.jp |
orientalcollection.jp | NS | 86396 |
Target:ns4.xserver.jp |
orientalcollection.jp | NS | 86396 |
Target:ns2.xserver.jp |
orientalcollection.jp | SOA | 86400 |
MNAME:ns1.xserver.jp RNAME:root.sv0.xserver.jp Refresh:10800 Retry:3600 Expire:604800 |
orientalcollection.jp | MX | 86400 |
Target:orientalcollection.jp |
Similarly Ranked Websites to Orientalcollection
Cheap Flights | Discount Airfare | Airline Tickets | Cheapseats.com
- cheapseats.com
Terri Johnson Creates
- terrijohnsoncreates.com
Sharing Tips and Tutorials for my Sewing, Embroidery and Silhouette Cameo creations
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org
Full WHOIS Lookup for orientalcollection.jp
[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]
Domain Information:
[Domain Name] ORIENTALCOLLECTION.JP
[Registrant] Xserver Inc.
[Name Server] ns1.xserver.jp
[Name Server] ns2.xserver.jp
[Name Server] ns3.xserver.jp
[Name Server] ns4.xserver.jp
[Name Server] ns5.xserver.jp
[Signing Key]
[Created on] 2001/09/07
[Expires on] 2017/09/30
[Status] Active
[Last Updated] 2016/10/01 01:05:10 (JST)
Contact Information:
[Name] XSERVER Inc.
[Email] [email protected]
[Web Page] http://www.xserver.co.jp
[Postal code] 530-0011
[Postal Address] GRAND FRONT OSAKA TOWER A 13F,
4-20, Ofukacho,
Kita-ku, Osaka-City, Osaka
[Phone] 06-6292-8811
[Fax] 06-6292-8812
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]
Domain Information:
[Domain Name] ORIENTALCOLLECTION.JP
[Registrant] Xserver Inc.
[Name Server] ns1.xserver.jp
[Name Server] ns2.xserver.jp
[Name Server] ns3.xserver.jp
[Name Server] ns4.xserver.jp
[Name Server] ns5.xserver.jp
[Signing Key]
[Created on] 2001/09/07
[Expires on] 2017/09/30
[Status] Active
[Last Updated] 2016/10/01 01:05:10 (JST)
Contact Information:
[Name] XSERVER Inc.
[Email] [email protected]
[Web Page] http://www.xserver.co.jp
[Postal code] 530-0011
[Postal Address] GRAND FRONT OSAKA TOWER A 13F,
4-20, Ofukacho,
Kita-ku, Osaka-City, Osaka
[Phone] 06-6292-8811
[Fax] 06-6292-8812